PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011099224.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 335aa    MW: 35156.2 Da    PI: 8.905
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011099224.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.53.5e-3964122361
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     +++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk++
  XP_011099224.1  64 SENLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKNT 122
                     57899***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.2E-3266121IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-2567118IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.54467121IPR003851Zinc finger, Dof-type
PROSITE patternPS01361069105IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MIQELLGGSN VSIIGGERSK LSTPVCGGIL DGSPSHSLPS SSPSPSSSST SVGTTAAAAA  60
AAASENLRCP RCDSSNTKFC YYNNYNLTQP RHFCKTCRRY WTKGGALRNV PIGGGCRKNK  120
NTTITTAVGK SSSAGKLKTV SQELGKSGLF SGFDHAEALS ANPILWASSQ NSHFLSLLRA  180
NQSPNPTHLP NSISVKEENA LFGSSHLSQE SSISSGGLNP RVMSLDPLAP IHLPSMGQSN  240
SLYRNQTQPA RVGIIHGEVQ NNGLQELYQR LRSSSSTSCY PENAQVILGN VASAASSTAS  300
AILESAPVAA PGEFGFWNPT ISWPTDLPTT NGAYP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099224.10.0PREDICTED: dof zinc finger protein DOF1.1-like
TrEMBLA0A067KJ601e-107A0A067KJ60_JATCU; Uncharacterized protein
TrEMBLA9P9B51e-107A9P9B5_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11620.11e-106(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.16e-34TARGET OF MONOPTEROS 6